HRSV Glycoprotein G (Strain A2), His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	HRSV
Synonyms	Major surface glycoprotein G, Attachment glycoprotein G, Membrane-bound glycoprotein (mG)
Accession	P03423
Amino Acid Sequence	Protein sequence(P03423, Ser64-Gln298, with C-10*His) SANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Theoretical:27.2kDa Actual:45-110kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Respiratory syncytial virus G protein is a protein produced by respiratory syncytial virus. The viral G protein is a highly glycosylated 90 kDa transmembrane protein, primarily responsible for the attachment of RSV to the host cell. Though not required for the production of infectious RSV or virus-like particles, RSV G is necessary for full infectivity and is found on the membrane of mature filaments. Additionally, RSV G interacts with both RSV M and F protein, which appears to be required for complete virion assembly.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.