Species | HRSV |
Synonyms | Major surface glycoprotein G, Attachment glycoprotein G, Membrane-bound glycoprotein (mG) |
Accession | P03423 |
Amino Acid Sequence | Protein sequence(P03423, Ser64-Gln298, with C-10*His)
SANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQGGGGSHHHHHHHHHH |
Expression System | HEK293 |
Molecular Weight | Theoretical:27.2kDa Actual:45-110kDa |
Purity | >95% by SDS-PAGE |
Endotoxin | <1EU/μg |
Tag | His Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |