Recombinant Human CD9 antigen(CD9),Cusabio Biotech Co., Ltd_specification/price/image

Product Detail
Company Profile

Product Name: Recombinant Human CD9 antigen(CD9)

Product Type: Transmembrane Protein

Code: CSB-CF004969HU

Size: 10μg

Uniprot NO.: P21926

Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Storage Buffer: Tris-based buffer,50% glycerol

Species: Homo sapiens (Human)

Sequence: PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

Gene Names: CD9Synonyms:MIC3,TSPAN29,GIG2

Protein Names: Recommended name: CD9 antigenAlternative name(s): 5H9 antigen Cell growth-inhibiting gene 2 protein Leukocyte antigen MIC3 Motility-related protein Short name= MRP-1 Tetraspanin-29 Short name= Tspan-29 p24 CD_antigen= CD9

Expression Region: 2-228

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Product Info: His-SUMO-tag

Protein Description: full length protein

More details, please refer to http://www.cusabio.com/Transmembrane-Protein/Recombinant-Human-CD9-antigenCD9-11153744.html

Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.