Product Name: Recombinant Human CD63 antigen(CD63)
Product Type: Transmembrane Protein
Code: CSB-CF004950HU
Size: 10μg
Uniprot NO.: P08962
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Storage Buffer: Tris-based buffer,50% glycerol
Species: Homo sapiens (Human)
Sequence: AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Gene Names: CD63Synonyms:MLA1,,TSPAN30
Protein Names: Recommended name: CD63 antigenAlternative name(s): Granulophysin Lysosomal-associated membrane protein 3 Short name= LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30 Short name= Tspan-30 CD_anti
Expression Region: 2-238
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info: His-SUMO-tag
Protein Description: full length protein
bio-equip.cn
中文
