Product Name: Recombinant Rat Beta-2 adrenergic receptor(Adrb2)
Product Type: Transmembrane Protein
Code: CSB-CF001392RA
Size: 10μg
Uniprot NO.: P10608
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Storage Buffer: Tris-based buffer,50% glycerol
Species: Rattus norvegicus (Rat)
Sequence: MEPHGNDSDFLLAPNGSRAPGHDITQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKQAIDCYAKETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRSSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRANLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNGRTDYTGEQSAYQLGQEKENELLCEEAPGMEGFVNCQGTVPSLSIDSQGRNCNTNDSPL
Gene Names: Adrb2Synonyms: Adrb2r
Protein Names: Recommended name: Beta-2 adrenergic receptorAlternative name(s): Beta-2 adrenoreceptor Short name= Beta-2 adrenoceptor
Expression Region: 1-418
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info: His-SUMO-tag
Protein Description: full length protein
More details, please refer to http://www.cusabio.com/Transmembrane-Protein/Recombinant-Rat-Beta-2-adrenergic-receptorAdrb2-11153769.html
bio-equip.cn
Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.
中文
