Product Name: Recombinant Human 5-hydroxytryptamine receptor 2C(HTR2C)
Product Type: Transmembrane Protein
Code: CSB-CF010889HU
Size: 10μg
Uniprot NO.: P28335
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Storage Buffer: Tris-based buffer, 50% glycerol
Species: Homo sapiens (Human)
Sequence: IVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
Gene Names: HTR2CSynonyms: HTR1C
Protein Names: Recommended name: 5-hydroxytryptamine receptor 2C Short name= 5-HT-2C Short name= 5-HT2C Short name= 5-HTR2CAlternative name(s): 5-hydroxytryptamine receptor 1C Short name= 5-HT-1C Short name= 5-HT1C Serotonin receptor 2C
Expression Region: 33-458
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info: His-SUMO-tag
Protein Description: full length protein
More details, please refer to http://www.cusabio.com/Transmembrane-Protein/Recombinant-Human-5-hydroxytryptamine-receptor-2CHTR2C-11153770.html
bio-equip.cn
Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.
中文
