Recombinant Balaenoptera musculus ATP synthase protein 8(MT-ATP8),Cusabio Biotech Co., Ltd_specification/price/image

Product Detail
Company Profile

Product Name: Recombinant Balaenoptera musculus ATP synthase protein 8(MT-ATP8)

Product Type: Transmembrane Protein

Code: CSB-CF015071BEC

Size: 10μg

Uniprot NO.: P41292

Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Storage Buffer: Tris-based buffer,50% glycerol

Species: Balaenoptera musculus (Blue whale)

Sequence: MPQLDTSTWLLTILSMLLTLFVLFQLKISKHSYSPNPKLVPTKTQKQQTPWNITWTKIYLPLL

Gene Names: MT-ATP8Synonyms:ATP8,,ATPASE8,,MTATP8

Protein Names: Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8

Expression Region: 1-63

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Product Info: His-SUMO-tag

Protein DescriptionL: full length protein

More details, please visit http://www.cusabio.com/Transmembrane-Protein/Recombinant-Balaenoptera-musculus-ATP-synthase-protein-8MT-ATP8-11153780.html

Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.