CD36/SR-B3 His Tag Protein, Cynomolgus,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Cynomolgus
Synonyms	CD36, SR-B3, SCARB3, BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV
Accession	Q4R6B4
Amino Acid Sequence	Gly30-Asn439, with C-terminal 10*His GDMLIQKTIKKEVVLEEGTIAFKNWVKTGTEIYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENITQDPKDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYPNPFVQVVLNSLINKSKSSMFQVRTLRELLWGYTDPFLSLVPYPVSTRVGMFYPYNNTADGVYKVFNGKDSISKVAIIDTYKGKRNLSYWESYCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVQNPDNHCFCTEKIISKNCTSYGVLDISKCKEGKPVYISLPHFLYASPDVSETIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSNKIQVLKRLKRNYIVPILWLNETGTIGDEKAKMFRSQVTGKINGGGSGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	72-82kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Okamoto F. et al. (1998) CD36 abnormality and impaired myocardial long-chain fatty acid uptake in patients with hypertrophic cardiomyopathy. Jpn Circ J. 62: 499-504. 2、Tanaka T. et al. (1997) Is CD36 deficiency an etiology of hereditary hypertrophic cardiomyopathy? J Mol Cell Cardiol. 29: 121-127. 3、Forte E. et al. (2018) The interstitium in cardiac repair: role of the immune-stromal cell interplay. Nat Rev Cardiol. 15: 601-616. 4、Coraci I S. et al. (2002) CD36, a class B scavenger receptor, is expressed on microglia in Alzheimer’s disease brains and can mediate production of reactive oxygen species in response to -amyloid fibrils. Am. J. Pathol. 160: 101-112.

Background

CD36 belongs to the scavenger receptor class B (SR-B), a family of highly glycosylated transmembrane receptors with a wide range of ligand recognition sites. It has been reported that glycosylation of CD36 is required for trafficking of intracellular CD36 to the cell surface membrane. Because of its wide range of ligands, CD36 has plenty of functions, including but not limited to recognizing and ingesting lipids, participating in the process of inflammatory response, signal transduction, and apoptosis. The expression occurs in monocytes/macrophages and microglia as well as various other cells and tissues, including microvascular endothelial cells, platelets, adipocytes, and the heart. CD36 promotes the podocyte injury in many kidney diseases including primary nephrotic syndrome, obesity-related glomerulopathy, and diabetic nephropathy. Moreover, genetic knockout or antagonist blockade of CD36 could alleviate kidney injury indicating that CD36 is a potential therapeutic target.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.