Home >Products> Reagents >Other Reagents> Biotinylated BCMA Fc&Avi Tag Protein, Human
Reagents:  Molecular Biology   Biochemistry   Cell Biology   ELISA / Diagnostic Kits   Antibody   Serum/Medium   Other Reagents  
Biotinylated BCMA Fc&Avi Tag Protein, Human
Biotinylated BCMA Fc&Avi Tag Protein, Human
Place of Origin:
Singapore
Brand:
UA BIOSCIENCE
Model:
UA010461-25μg
Price:
512
Hits:
53 
Updated:
3/2/2026
  • Product Detail
  • Company Profile

    Product Specification


    SpeciesHuman
    AntigenBCMA
    SynonymsTNFRSF17, CD269, BCM, BCMA
    AccessionQ02223-1
    Amino Acid Sequence

    Met1-Ala54, with C-terminal Human IgG1 Fc &Avi tag

    MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE


    Expression SystemHEK293
    Molecular Weight

    38-45kDa (Reducing)

    Purity>95% by SDS-PAGE
    Endotoxin<0.1EU/μg
    ConjugationBiotin
    TagHuman Fc Tag, Avi Tag
    Physical AppearanceLyophilized Powder
    Storage BufferPBS, pH7.4
    ReconstitutionReconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
    Stability & Storage· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
    · 3 months, -20 to -80℃ under sterile conditions after reconstitution.
    · 1 week, 2 to 8℃ under sterile conditions after reconstitution.
    · Please avoid repeated freeze-thaw cycles.
    Reference

    1.Nina Shah, Ajai Chari, Emma Scott, Khalid Mezzi& Saad Z. Usmani: B-cell maturation antigen (BCMA) in multiple myeloma:rationale for targeting and current therapeutic approaches, Leukemia volume 34, pages985–1005 (2020).


    Background

    BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.


    bio-equip.cn
    AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
Request Information
Request Information: yes no
Request Quotation: yes no
refresh

I agree to share my inquiry with the other matching suppliers.

Request Information

* Name:
Job Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request Information:
yes no
Request Quotation:
yes no
* Message:
* Verification Code:
refresh
I agree to share my inquiry to the other matching suppliers.