| Species | Human |
| Antigen | EPCR/PROCR |
| Synonyms | CD350 antigen, CD350, frizzled (Drosophila) homolog 10, frizzled homolog 10 (Drosophila), Frizzled10, Frizzled-10, Fz10, FZ-10, FZD10, FzE7, hFz10 |
| Accession | Q9ULW2 |
| Amino Acid Sequence | Ile21-Gly161, with C-terminal 8*His
ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 19-24kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
| Reference | 1. Cell Signal . 2006 Jul;18(7):934-41. Epub 2006 Feb 9. |