| Species | Cynomolgus |
| Synonyms | IL3R, IL3RA, IL-3Ra, IL-3R-alpha, IL3RAY, IL3RX, IL3RY, CD123 antigen, hIL3Ra, hIL-3Ra, MGC34174, IL-3 R alpha |
| Accession | G8F3K3-1 |
| Amino Acid Sequence | Arg18-Arg302, with C-terminal 8*His
RTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSMPAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFLSCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIAPLSRGSQSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYELRIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGASSRGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 50-65kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
| Reference | 1. LIU, KEQIANG, ZHU, MENGRU, HUANG, YAO, et al. CD123 and its potential clinical application in leukemias [J]. Life sciences,2015,122(1):59-64. |