Species | Cynomolgus |
Synonyms | IL3R, IL3RA, IL-3Ra, IL-3R-alpha, IL3RAY, IL3RX, IL3RY, CD123 antigen, hIL3Ra, hIL-3Ra, MGC34174, IL-3 R alpha |
Accession | G8F3K3-1 |
Amino Acid Sequence | Arg18-Arg302, with C-terminal 8*His
RTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSMPAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFLSCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIAPLSRGSQSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYELRIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGASSRGGGSHHHHHHHH |
Expression System | HEK293 |
Molecular Weight | 50-65kDa |
Purity | >95% by SDS-PAGE |
Endotoxin | <0.1EU/μg |
Conjugation | Unconjugated |
Tag | His Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | PBS, pH7.4 |
Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
Reference | 1. LIU, KEQIANG, ZHU, MENGRU, HUANG, YAO, et al. CD123 and its potential clinical application in leukemias [J]. Life sciences,2015,122(1):59-64. |