| Species | Human |
| Synonyms | Epididymis Secretory Sperm Binding Protein Li 171mP, CD52 Antigen (CAMPATH-1 Antigen), Epididymal Secretory Protein E5, He5, CDW52 Antigen, HEL-S-171mP, EDDM5, CDw52, Cambridge pathology 1 antigen, Human epididymis-specific protein 5, CD52 Molecule |
| Accession | P31358 |
| Amino Acid Sequence | Gly25-Ser36, with C-terminal human IgG1 Fc &Avi tag
GQNDTSQTSSPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE |
| Expression System | HEK293 |
| Molecular Weight | 35-43kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Biotin |
| Tag | Avi Tag, Mouse Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
| Reference | 1. Koyama K. et al. (2009) Functional aspects of CD52 in reproduction. J Reprod Immunol. 83(1-2): 56-59.
2. Morris, P.J. and N.K. Russell (2006) Transplantation 81:1361.
3. Redpath, S. et al. (1998) Immunology 93:595.
4. Hardiyanto, L. et al. (2012) J. Reprod. Immunol. 94:142. |
中文
