Human CD1D Protein, His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Antigen-presenting glycoprotein CD1d, R3G1, CD1d
Accession	P15813
Amino Acid Sequence	Protein sequence (P15813, Val21-Gly296, with C-His tag) VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWG
Expression System	HEK293
Molecular Weight	Predicted MW: 33 kDa Observed MW: 43-55 kDa
Purity	锛?0% by SDS-PAGE
Endotoxin	<1EU/渭g
Conjugation	Unconjugated
Tag	with C-His tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD1D is a non-classical MHC class I-like glycoprotein specializing in lipid antigen presentation to T cells, particularly natural killer T (NKT) cells. Unlike classical MHC molecules, it presents lipid and glycolipid antigens via a unique binding groove. Expressed on antigen-presenting cells, CD1D bridges innate and adaptive immunity by activating NKT cells to secrete cytokines, influencing responses to infections, autoimmunity, and cancer. Genetic variants are associated with diseases like type 1 diabetes.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.