Human TPX2, His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Differentially expressed in cancerous and non-cancerous lung cells 2 (DIL-2), Hepatocellular carcinoma-associated antigen 519, Hepatocellular carcinoma-associated antigen 90, Protein fls353, Restricted expression proliferation-associated protein 100 (p100), C20orf1, C20orf2, DIL2, HCA519
Accession	Q9ULW0
Amino Acid Sequence	Protein sequence (Q9ULW0, Gln213-Asp349, with C-10*His) QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDGGGGSHHHHHHHHHH
Expression System	E.coli
Molecular Weight	Predicted MW: 17.9 kDa Observed MW: 18 kDa
Purity	＞90% by SDS-PAGE
Tag	with C-10*His
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Targeting protein for Xklp2 is a protein that in humans is encoded by the TPX2 gene. It is one of the many spindle assembly factors that play a key role in inducing microtubule assembly and growth during M phase. Because of its integral role in microtubule assembly and therefore mitosis, TPX2 is found to be overexpressed in different types of human cancers including hepatocellular carcinoma (HCC), medullary thyroid cancer, bladder carcinoma, and estrogen receptor-positive metastatic breast cancer and contributes to tumor growth and metastasis. As a result, TPX2 has recently been a topic of interest for learning more about the relationship between mitotic errors and tumorigenesis, along with novel cancer therapies.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.