Brain Natriuretic Peptide, Human,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Brain natriuretic peptide 32, Gamma-brain natriuretic peptide, B-type Natriuretic Peptide, GC-B, BNP-32
Accession	P16860
Amino Acid Sequence	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Expression System	E.coli
Molecular Weight	3.5 kDa (Reducing)
Purity	＞95%, by SDS-PAGE under reducing conditions
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Physical Appearance	Lyophilized Powder
Storage Buffer	20mM Tris-HCl, 200mM NaCl, pH8.5
Reconstitution	Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage	· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Background

Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.