Human Adiponectin, his tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein (ACRP30), Adipocyte, C1q and collagen domain-containing protein, Adipose most abundant gene transcript 1 protein (apM-1), Gelatin-binding protein, ACDC, ACRP30, APM1, GBP28
Amino Acid Sequence	Protein sequence (Q15848, Glu19-Asn244, with C-10*His) ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Predicted MW: 26.2 kDa Observed MW: 34 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Tag	with C-10*His
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Adiponectin (also referred to as GBP-28, apM1, AdipoQ and Acrp30) is a protein hormone and adipokine, which is involved in regulating glucose levels and fatty acid breakdown. In humans, it is encoded by the ADIPOQ gene and is produced primarily in adipose tissue, but also in muscle and even in the brain. Adiponectin is secreted from adipose tissue (and also from the placenta in pregnancy) into the bloodstream and is very abundant in plasma relative to many hormones. High adiponectin levels correlate with a lower risk of diabetes mellitus type 2. Adiponectin exerts some of its weight-reduction effects via the brain. This is similar to the action of leptin; adiponectin and leptin can act synergistically. Adiponectin promoted synaptic and memory function in the brain. Humans with lower levels of adiponectin have reduced cognitive function.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.