TOXGO SAG2（P22）, His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	TOXGO
Synonyms	Surface antigen P22
Accession	Q9NBH0
Amino Acid Sequence	Protein sequence(Q9NBH0, Ser27-Val187, with C-10*His) STTETPAPIECTAGATKTVEAPSSGSVVFQCGDKLTISPSGEGDVFYGKECTDSRKLTTVLPGAVLKAKVEQPPKGPATYTLSYDGTPEKPQVLCYKCVAEAGAPAGRNNDGGSSAPTPKDCKLIVRVPGADGRVTSGFDPVSLTGKVLAPGLAGLLITFVGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Theoretical:18.0kDa Actual:21kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Toxoplasmosis is a parasitic disease caused by Toxoplasma gondii, an apicomplexan. Infections with toxoplasmosis are associated with a variety of neuropsychiatric and behavioral conditions. SAG2A is a 22 kDa protein that is mainly found in the surface of tachyzoites.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.