Species | Human |
Synonyms | C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), Monocyte-derived neutrophil chemotactic factor (MDNCF), CXCL8 |
Accession | P10145 |
Amino Acid Sequence | Protein sequence(P10145, Ser28-Ser99, with C-10*His)
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH |
Expression System | CHO |
Molecular Weight | Theoretical:10.1kDa Actual:10kDa |
Purity | >95% by SDS-PAGE |
Endotoxin | <1EU/μg |
Tag | His Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |