Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 1(SRD5A1),Cusabio Biotech Co., Ltd_specification/price/image

Product Detail
Company Profile

Product Name: Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 1(SRD5A1)

Product Type: Transmembrane Protein

Code: CSB-CF022653HU

Size: 10μg

Uniprot NO.: P18405

Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Storage Buffer: Tris-based buffer,50% glycerol

Species: Homo sapiens (Human)

Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF

Gene Names: SRD5A1

Protein Names: Recommended name: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 EC= 1.3.99.5Alternative name(s): SR type 1 Steroid 5-alpha-reductase 1 Short name= S5AR 1

Expression Region: 1-259

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Product Info: His-SUMO-tag

Protein Description: full length protein

More details, please refer to http://www.cusabio.com/Transmembrane-Protein/Recombinant-Human-3-oxo-5-alpha-steroid-4-dehydrogenase-1SRD5A1-11153748.html

Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.