Recombinant Human Vitamin K-dependent gamma-carboxylase(GGCX),Cusabio Biotech Co., Ltd_specification/price/image

Product Detail
Company Profile

Product Name: Recombinant Human Vitamin K-dependent gamma-carboxylase(GGCX)

Product Type: Transmembrane Protein

Code: CSB-CF009388HU

Size: 10μg

Uniprot NO.: P38435

Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Storage Buffer: Tris-based buffer,50% glycerol

Species: Homo sapiens (Human)

Sequence: AVSAGSARTSPSSDKVQKDKAELISGPRQDSRIGKLLGFEWTDLSSWRRLVTLLNRPTDPASLAVFRFLFGFLMVLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTIMFLGALGMMLGLCYRISCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWSVDGLLNAHRRNAHVPLWNYAVLRGQIFIVYFIAGVKKLDADWVEGYSMEYLSRHWLFSPFKLLLSEELTSLLVVHWGGLLLDLSAGFLLFFDVSRSIGLFFVSYFHCMNSQLFSIGMFSYVMLASSPLFCSPEWPRKLVSYCPRRLQQLLPLKAAPQPSVSCVYKRSRGKSGQKPGLRHQLGAAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF

Gene Names: GGCXSynonyms:GC

Protein Names: Recommended name: Vitamin K-dependent gamma-carboxylase EC= 4.1.1.90Alternative name(s): Gamma-glutamyl carboxylase Peptidyl-glutamate 4-carboxylase Vitamin K gamma glutamyl carboxylase

Expression Region: 2-758

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Product Info: His-SUMO-tag

Protein Description: full length protein

More details, please refer to http://www.cusabio.com/Transmembrane-Protein/Recombinant-Human-Vitamin-K-dependent-gamma-carboxylaseGGCX-11153755.html

Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.