Recombinant Chicken Frizzled-7(FZD7),Cusabio Biotech Co., Ltd_specification/price/image

Product Detail
Company Profile

Product Name: Recombinant Chicken Frizzled-7(FZD7)

Product Type: Transmembrane Protein

Code: CSB-CF009110CH

Size: 10μg

Uniprot NO.: O57329

Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Storage Buffer: Tris-based buffer,50% glycerol

Species: Gallus gallus (Chicken)

Sequence: AHHEDKAISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAPPGPGGAGGRGATAQPTAGYLPDLLTPPQPAAGFSFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRPNGLMYFKEAEVRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYAAGFLLEERVVCLERFSEDGYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGIYSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVVACYFYEQAFRSTWEKTWLLQTCKTYAVPCPSHFAPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSTGSKGETAV

Gene Names: FZD7Synonyms:FZ7

Protein Names: Recommended name: Frizzled-7 Short name= Fz-7 Short name= cFz-7

Expression Region: 32-567

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Product Info: His-SUMO-tag

Protein Description: full length protein

More details, please visit http://www.cusabio.com/Transmembrane-Protein/Recombinant-Chicken-Frizzled-7FZD7-11153779.html

Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.