Home >Products> Reagents >Biochemistry> Recombinant Human Interleukin-17A ( MBP tagged) ( IL17A)
Reagents:  Molecular Biology   Biochemistry   Cell Biology   ELISA / Diagnostic Kits   Antibody   Serum/Medium   Other Reagents  
Recombinant Human Interleukin-17A ( MBP tagged) ( IL17A)
Recombinant Human Interleukin-17A ( MBP tagged) ( IL17A)
Place of Origin:
United States
Brand:
Biowit
Model:
RP1008
Price:
$500/100UG
Hits:
1065 
Updated:
5/4/2012
  • Product Detail
  • Company Profile

    Recombinant Human Interleukin-17A ( MBP tagged) ( IL17A)

    Recombinant (E. coli)

    Lyophilizate, sterile-filtered

    Cat.No.     RP1008                       100 μg                  store at -20 ℃

    Synonyms :  CTLA-8, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, IL17A.

    Description: Interleukin-17A Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 138 amino acids fragment and having a molecular weight of 61kDa. The IL-17A is fused to a 42KDa MBP tag at its N-terminus and purified by proprietary chromatographic techniques.

    Source:        Escherichia coli.

    Purity:         Greater than 95.0% as determined by SDS-PAGE.

    Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.

    Amino acid sequence:

    METKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMETFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMETNADTDYSIAEAAFNKGETAMETTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMETENAQKGEIMETPNIPQMETSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGIEGRISEFGSMETIVKAGITIPRNPGCPNSEDKNFPRTVMETVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMETNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCT CVTPIVHHVA

    Formulation & Storage: It was lyophilized from sterile 10 mM sodium phosphate ( pH 6.0) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Upon reconstitution Interleukin-17A should be stored at 4°C. For long-term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.

    Usage:  The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.

    bio-equip.cn
    Biowit Technologies Ltd. is a high-tech company specialized in providing R&D services and related products in the biological field. As a technology-driven and customer-focused company, BioWit provides a broad and integrated service and product portfolio including molecular biology, virus packaging (e.g., adenovirus, AAV, lentivirus, retrovirus and baculovirus), protein expression, cell biology, stem cells and transgenic models. One of the milestones achieved by Biowit is its recent sucess in the development of a series of serum-containing media as well as serum-free or animal -free media for stem cell culture, which are tailored for clinical applications. The core technology team members have engaged in research and development for many years in world-famous academic institutions or prestigious drug companies. Biowit has established collaboration with international prestigious research institutions. The worldwide collaboration enables Biowit to timely renew its biotechnologies (http://www.biowit.com).

Request Information
Request Information: yes no
Request Quotation: yes no
refresh

I agree to share my inquiry with the other matching suppliers.

Request Information

* Name:
Job Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request Information:
yes no
Request Quotation:
yes no
* Message:
* Verification Code:
refresh
I agree to share my inquiry to the other matching suppliers.