Product Specification
| Species | Human |
| Synonyms | MUC-1, EMA, MCD, PEM |
| Accession | P15941-1 |
| Amino Acid Sequence | Leu1036-Gly1155, with C-terminal 8*His
LSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 11-15&8kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
| Reference | 1、Qing L. et al. (2022) MUC1: An emerging target in cancer treatment and diagnosis. Bull Cancer. 109(11): 1202-1216. |
Background
MUC1 is a highly glycosylated transmembrane mucin on the luminal surface of epithelial cells, protecting them from extreme factors. In cancer cells, MUC1 expression is upregulated and the protein structure, glycosylation level and spatial distribution are altered. It was found that upregulated MUC1 is involved in the regulation of several signaling pathways and plays an instrumental role in tumor cell metabolism, apoptosis, epithelial mesenchymal transition and distant metastasis. MUC1 glycosylation insufficiency leads to exposure of novel antigenic epitopes that can be used as specific targets for therapy and diagnosis. In addition, MUC1 was found to be closely related to HIF and can form a positive feedback loop leading to hypoxic malignant tumor progression. Currently, MUC1-based targeted drugs include monoclonal antibodies, antibody-coupled drugs, aptamers and cancer vaccines, some of which have already entered clinical trials.
bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.