Home >Products> Reagents >Other Reagents> Fc epsilon RI α Fc Chimera Protein, Human
Reagents:  Molecular Biology   Biochemistry   Cell Biology   ELISA / Diagnostic Kits   Antibody   Serum/Medium   Other Reagents  
Fc epsilon RI α Fc Chimera Protein, Human
Fc epsilon RI α Fc Chimera Protein, Human
Place of Origin:
Singapore
Brand:
UA BIOSCIENCE
Model:
UA010147-100μg
Price:
600
Hits:
16 
Updated:
9/1/2025
  • Product Detail
  • Company Profile

    Product Specification


    SpeciesHuman
    AntigenFc epsilon RI
    AccessionP12319-1
    Amino Acid Sequence

    Val 26-Leu204, with C-terminal Human IgG1 Fc

    VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

    Expression SystemHEK293
    Molecular Weight65-72kDa (Reducing)
    Purity

    >95% by SDS-PAGE

    Endotoxin<0.1EU/μg
    ConjugationUnconjugated
    TagHuman Fc Tag
    Physical AppearanceLyophilized Powder
    Storage BufferPBS, pH7.4
    ReconstitutionReconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
    Stability & Storage· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
    · 3 months, -20 to -80℃ under sterile conditions after reconstitution.
    · 1 week, 2 to 8℃ under sterile conditions after reconstitution.
    · Please avoid repeated freeze-thaw cycles.

    Background

    Fc epsilon RI, the high-affinity IgE receptor, distinguishes Ag-IgE interactions and drives cellular allergic responses. Fc epsilon RI is primarily expressed on MCs, basophils and Ag-presenting cells, and mainly exists as the heterotetramer αβγ2. However, there are differences among species: an alternate trimeric form αγ2 is expressed on human, but not rodent. Structurally, it is composed of one α-chain bearing two extracellular immunoglobulin domains that bind to the Fc portion of a single molecule of IgE, a β-chain that holds an immunoreceptor tyrosine-based activation motif (ITAM), and a homodimer of disulfide-bound ITAM-containing γ-chains. Expression of the β chain in mast cells and basophils results in increased Fc epsilon RI surface expression and amplifies signaling through the receptor. The importance of the α-subunit in the Fc epsilon RI-mediated allergic reaction was demonstrated by the absence of allergic reactions in α-subunit-deficient mice. The Fc epsilon RIα binds to the Fc fragment of IgE at a 1:1 ratio to form the IgE-Fc complex. Fc epsilon RI is a unique molecular target that initiates different functional outcomes of MC responses and allergic inflammation. The recognition of multivalent antigen by Fc epsilon RI-bound IgE triggers a complex biochemical pathway initiated by the phosphorylation of ITAM motifs by the Src family kinase Lyn. Fc epsilon RI not occupied by IgE has a half-life on the mast cell surface of 24 hours in vitro, while receptors bound to IgE appear to be expressed for the life of the cell. The density of human basophil FcεR1 expression correlates directly with serum IgE levels, where binding of IgE stabilizes the receptor at the cell surface.

    bio-equip.cn
    AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
Request Information
Request Information: yes no
Request Quotation: yes no
refresh

I agree to share my inquiry with the other matching suppliers.

Request Information

* Name:
Job Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request Information:
yes no
Request Quotation:
yes no
* Message:
* Verification Code:
refresh
I agree to share my inquiry to the other matching suppliers.