IL-2R alpha/CD25 His Tag Protein, Mouse,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	IL-2R alpha/CD25
Synonyms	IL2RA, CD25, p55, IL2-RA, IL-2-RA
Accession	P01590
Amino Acid Sequence	Glu22-Lys236, with C-terminal 8*His ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	43-65kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Driesen J. et al. (2008) CD25 as an immune regulatory molecule expressed on myeloid dendritic cells. Immunobiology. 213(9-10): 849-858. 2、Bien E. et al. (2008) Serum soluble interleukin 2 receptor alpha in human cancer of adults and children: a review. Biomarkers. 13(1): 1-26.

Background

The pleiotropic interleukin-2 (IL-2) cytokine is a central modulator of immune responses by shaping the differentiation and effector function of T cells. The IL-2 receptor α (IL-2Rα) is the unique chain of the trimeric IL-2 receptor and increases affinity and cells’ responsiveness to IL-2. IL-2Rα can be cleaved by different proteases resulting in soluble IL-2Rα (sIL-2Rα). Contrary to cell-bound IL-2Rα, several studies point to an antagonist role of sIL-2Rα on IL-2 signaling by interfering with binding of IL-2 to the cell-bound receptor and diminishing STAT5 phosphorylation, thereby inhibiting induction of the expression of cell bound IL-2Rα and increasing differentiation of the T cell response towards a T helper 17 phenotype, a T cell phenotype normally inhibited by IL-2.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.