MSLN/Mesothelin (37-286) His Tag Protein, Human,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Accession	Q13421-1
Amino Acid Sequence	Leu37-Arg286, with C-terminal 8*His LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERHHHHHHHH
Expression System	HEK293
Molecular Weight	30-33kDa (Reducing)
Purity	>95% by SDS-PAGE&RP-HPLC
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Background

Mesothelin (MSLN) is also known as CAK1 antigen, Pre-pro-megakaryocyte potentiating factor, which belongs to the mesothelin family. Mesothelin/MSLN can be proteolytically cleaved into the following two chains by a furin-like convertase: Megakaryocyte-potentiating factor (MPF) and the cleaved form of mesothelin. Both MPF and the cleaved form of mesothelin are N-glycosylated. Mesothelin/MSLN can interacts with MUC16. The membrane-anchored form of MSLN may play a role in cellular adhesion. MPF potentiates megakaryocyte colony formation in vitro.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.