Home >Products> Reagents >Other Reagents> MUC-1(33-167) Fc Chimera Protein, Human
Reagents:  Molecular Biology   Biochemistry   Cell Biology   ELISA / Diagnostic Kits   Antibody   Serum/Medium   Other Reagents  
MUC-1(33-167) Fc Chimera Protein, Human
MUC-1(33-167) Fc Chimera Protein, Human
Place of Origin:
Singapore
Brand:
UA BIOSCIENCE
Model:
UA010158-100μg
Price:
560
Hits:
42 
Updated:
3/2/2026
  • Product Detail
  • Company Profile

    Product Specification


    SpeciesHuman
    SynonymsCD227 antigen, CD227, DF3 antigen, EMA, Episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, Mucin-1,
    Amino Acid Sequence

    Ser33-Gly167, with C-terminal Human IgG1 Fc

    SGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

    Expression SystemHEK293
    Molecular Weight87-113kDa (Reducing)
    Purity

    >95% by SDS-PAGE

    Endotoxin<0.1EU/μg
    ConjugationUnconjugated
    TagHuman Fc Tag
    Physical AppearanceLyophilized Powder
    Storage BufferPBS, pH7.4
    ReconstitutionReconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
    Stability & Storage· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
    · 3 months, -20 to -80℃ under sterile conditions after reconstitution.
    · 1 week, 2 to 8℃ under sterile conditions after reconstitution.
    · Please avoid repeated freeze-thaw cycles.

    Background

    Mucin 1 (MUC1) is a highly glycosylated transmembrane protein expressed mainly on the apical surface of most glandular epithelial cells, including those of the mammary gland, lung, pancreas, kidney, female reproductive tract and stomach. It is also expressed on MM cell lines, fresh patient MM cells, and plasmacytomas, as well as other hematological malignancies, including Ki-1-positive B-cell lymphomas, T-cell lymphomas, Hodgkin's disease, and malignant histiocytosis. MUC1 functions primarily in the formation of a physical barrier to lubricate and protect normal epithelial tissues and mediate signal transduction. However, aberrant expression of MUC1 occurs in cancer cells, including those of esophageal cancer, gastric cancer, breast cancer, ovarian cancer, bladder cancer and other tumors, and is especially prominent in breast cancer cells. The biological structure of MUC1 consists of both a C-terminal fragment (MUC1-C) and an N-terminal fragment (MUC1-N) linked by non-covalent interactions. Furthermore, the C-terminal fragment comprises an extracellular region, a transmembrane region and an intracellular region. Among these regions, the transmembrane region (28 amino acids) and intracellular region (72 amino acids) are highly conserved. The N-terminal fragment is located on the membrane surface and contains the signal peptide, the (30–90) variable number tandem repeat (VNTR) region, and the sea urchin sperm protein, enterokinase and agrin (SEA) domain. Aberrantly glycosylated MUC1 is associated with cellular transformation from a normal to malignant phenotype in human cancers.  Furthermore, Muc-1 binds to intercellular adhesion molecule-1 (ICAM-1), suggesting a role in cellular migration.

    bio-equip.cn
    AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
Request Information
Request Information: yes no
Request Quotation: yes no
refresh

I agree to share my inquiry with the other matching suppliers.

Request Information

* Name:
Job Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request Information:
yes no
Request Quotation:
yes no
* Message:
* Verification Code:
refresh
I agree to share my inquiry to the other matching suppliers.