| Species | Human |
| Synonyms | FKBP-12, FKBP-1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE |
| Accession | P62942 |
| Amino Acid Sequence | Met1-Glu108, with C terminal 8*His Tag
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 13kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
| Reference | 1. Curr Genet. 2021 Jun;67(3):383-388.
2. Genetics. 1999 Mar;151(3):935-44. |
中文
