| Species | Human |
| Synonyms | Fatty acid binding protein 7 |
| Accession | O15540 |
| Amino Acid Sequence | Val2-Ala132, with N-terminal 8*His
MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|