Species | Human |
Synonyms | Fatty acid binding protein 8, P2, PMP2 |
Accession | P02689 |
Amino Acid Sequence | Ser2-Val132, with N-terminal 8*His
MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
Expression System | E.coli |
Molecular Weight | 18kDa (Reducing) |
Purity | >95% by SDS-PAGE & RP-HPLC |
Endotoxin | <1EU/μg |
Conjugation | Unconjugated |
Tag | His Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|