CEACAM-7 His Tag Protein, Human,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	CEA, CEACAM 7, CGM 2, CGM2
Accession	Q14002
Amino Acid Sequence	Thr36-Ser242, with C-terminal 8*His TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	33-55kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Tchoupa, A.K. et al. (2014) Cell Commun. Signal. 12:27.

Background

Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM-7), also known as CGM2, is an approximately 40 kDa GPI-anchored glycoprotein in the CEACAM family of adhesion molecules. Mature human CEACAM-7 consists of two Ig-like domains followed by the GPI anchor. Alternative splicing generates a short isoform that lacks the second Ig-like domain. CEACAM-7 is preferentially expressed on the luminal surface of epithelial cells near the mouth of colonic crypts and on pancreatic ductal epithelial cells. It is down-regulated during colorectal adeno

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.