PD-L1 Fc Chimera Protein, Human,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Programmed Cell Death 1 Ligand 1, PD-L1, PDCD1 Ligand 1, Programmed Death Ligand 1, B7 Homolog 1, B7-H1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1
Accession	Q9NZQ7
Amino Acid Sequence	Q9NZQ7, Phe19-Arg238, with C- hIgG1 Fc FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Expression System	HEK293
Molecular Weight	65-70 kDa (Reducing)
Purity	＞95%, by SDS-PAGE under reducing conditions
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	Human Fc Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.2, 5% trehalose
Reconstitution	Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Background

PD-L1, also known as B7-H1 and CD274, is a 290 amino acid transmembrane glycoprotein in the B7 family of immune regulatory molecules. It has an extracellular domain that can interact with PD-1, which belongs to the CD28/CTLA4 family expressed on activated lymphoid cells. The PD1/PD-L1 interaction ensures that activation of the immune system occurs at the appropriate time. This will minimize the possibility of chronic autoimmune inflammation. PD-L1 is known to inhibit proliferation of T cells via apoptosis. It also plays an important role in arresting cell-cycle progression. This makes PD-L1 an attractive therapeutic target for cancer and immunologic diseases.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.