PILRα His Tag Protein, Human,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	PILRα, PILRA, FDF03, AV021745
Accession	Q9UKJ1-1
Amino Acid Sequence	Gln20-Thr196, with C-terminal 8*His QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	41-47kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Shiratori I. et al. (2004) Activation of natural killer cells and dendritic cells upon recognition of a novel CD99-like ligand by paired immunoglobulin-like type 2 receptor. J Exp Med. 199: 525-533. 2、Satoh T. et al. (2008) PILRα is a herpes simplex virus-1 entry coreceptor that associates with glycoprotein B. Cell. 132: 935-944. 3、Wang J. et al. (2013) Neutrophilin filtration during inflammation is regulated by PILRαvia modulation ofintegrin activation. Nat Immunol. 14: 34-40. 4、Sun Y. et al. (2014) PILRα negatively regulates mouse inflammatoryarthritis. J Immunol. 193: 860-870.

Background

Paired immunoglobulin-like type 2 receptor α (PILRα) is an inhibitory receptor that is mainly expressed on macrophages, dendritic cells and granulocytes, and negatively regulates neutrophil infiltration during inflammation. PILRα containing two immunoreceptor tyrosine-based inhibitory motifs in the intracellular domain, which recruit Src homology region 2 domain-containing phosphatase (SHP)-1 and -2. Reported that PILRα associates with several ligands, including CD99, PILR-associating neural protein, neuronal differentiation proliferation factor-1, and collectin-12, and PILRα plays an important role in viral infections. Neutrophil recruitment in inflammatory responses is regulated by PILRα via modulation of integrin activation. Furthermore, negative regulation of inflammatory arthritis by PILRα has been reported.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.