FGL2 His Tag Protein, Mouse,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	FGL2, T49, pT49
Accession	P12804
Amino Acid Sequence	Pro197-Pro432, with C-terminal 8*His PVQHLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKPGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	38-43kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Feng Y. et al. (2020) Fibrinogen-Like Protein 2 (FGL2) is a Novel Biomarker for Clinical Prediction of Human Breast Cancer. Med Sci Monit. 26: e923531. 2、Hou X X. et al. (2021) Regulatory T cells induce polarization of pro-repair macrophages by secreting sFGL2 into the endometriotic milieu. Commun Biol. 4(1): 499.

Background

Fibrinogen-like protein 2 (FGL2) is a member of the fibrinogen-like protein family and possesses important regulatory functions in both innate and adaptive immune responses. Fibrinogen-like protein 2 (FGL2) exists in both soluble and membrane forms. Soluble fibrinogen-like protein 2 (sFGL2) has been recently identified as a novel effector molecule of Tregs and plays a pivotal role in regulating both innate and adaptive immunity. FGL2 mediates its immunosuppressive activity by binding to inhibitory FcγRIIB (CD32B) receptors expressed by antigen presenting cells (APC), including dendritic cells (DC) and B cells, and thus sFGL2 may inhibit the maturation of DC, resulting in the suppression of effector T cell responses and inducing apoptosis of B cells. However, nothing is known about sFGL2 and its potential roles in endometriosis.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.