IL-12 R beta 1 His Tag Protein, Human,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	IL-12 R beta 1, CD212, IMD30, IL12RB
Accession	P42701
Amino Acid Sequence	Cys24-Glu540, with C-terminal 8* His CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	74-84kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Oppmann B. et al. (2000) Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with biological activities similar as well as distinct from IL-12. Immunity. 13(5): 715-725. 2、Robinson R T. IL12Rbeta1: the cytokine receptor that we used to know. Cytokine. 2015;71(2): 348-359.

Background

The human IL-12 R subunit is a member of the cytokine receptor superfamily. The IL-12 R beta (IL-12Rβ) gene is located on chromosome 19p13 and has 17 exons. The receptor is composed of two subunits—IL-12Rβ1 and IL-12Rβ2—and is a member of the gp130 cytokine receptor superfamily. IL-12R are located mainly on T cells and NK cells, and stimulate TH1 and NK cell growth, while inhibiting TH2 cell responses. IL-12Rβ1 encodes the β1 chain common to the receptors for IL-12 and IL-23. Human IL-12Rβ1 is an autosomal gene that is essential for mycobacterial disease resistance and T cell differentiation. Mutations in the IL-12Rβ1 gene accounts for 38% of cases of MSMD. IL12Rβ1 is a cell surface receptor that binds the IL12p40 domain of IL12/IL23, and cooperates with co-receptors IL12Rβ2 or IL23R to initiate intracellular STAT signaling.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.