| Species | Human |
| Synonyms | hFz4, FzE4, CD344, Frizzled 4, Fz-4, EVR1, CD344, FZD4S, FEVR, GPCR |
| Accession | Q9ULV1 |
| Amino Acid Sequence | Phe37-Glu180, with C-terminal 8*His
FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 20-28kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
| Reference | 1、Nallathambi J. et al. (2006) Identification of novel FZD4 mutations in Indian patients with familial exudative vitreoretinopathy. Mol Vis. 12: 1086-1092. 2、Sjöblom T. et al. (2006) The consensus coding sequences of human breast and colorectal cancers. Science. 314(5797): 268-274. |
中文
