Product Specification
Species | Mouse |
Synonyms | MARCO, SCARA2, Macrophage receptor with collagenous structure, Scavenger receptor class A member 2 |
Accession | Q60754 |
Amino Acid Sequence | Gln70-Ser518, with N-terminal 10*His
HHHHHHHHHHGGGSGGGSQVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS |
Expression System | HEK293 |
Molecular Weight | 58-70kDa |
Purity | >95% by SDS-PAGE |
Endotoxin | <0.1EU/μg |
Conjugation | Unconjugated |
Tag | His Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | PBS, pH7.4 |
Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
Background
MARCO (macrophage receptor with collagenous structure), also known as SCARA2, is an 80 kDa type II transmembrane glycoprotein that belongs to the class A scavenger receptor family. MARCO is constitutively expressed on the surface of splenic and lymph node macrophages. Its expression is induced on Kupffer cells and alveolar macrophages by microbial infection, chemical irritants, and Th1 polarizing factors. MARCO binds LPS, lipoteichoic acid, and other determinants on Gram positive and negative bacteria. It also binds modified LDL, CpG oligonucleotides, UGRP1, silica, and TiO2. MARCO is required for the organization of the splenic marginal zone and the interaction of local macrophages and B cells.
bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.