Biotinylated FOLR1 His&Avi Tag Protein, Mouse,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	FOLR1, FBP, FOLR, FRα, Folate receptor 1, Folate-binding protein 1
Accession	P35846
Amino Acid Sequence	Thr25-Ser232, with C-terminal 8*His & Avi Tag TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGGGSHHHHHHHHGLNDIFEAQKIEWHE
Expression System	HEK293
Molecular Weight	33-43kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Biotin
Tag	Avi Tag, His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Senol S. et al. (2015) Folate receptor α expression and significance in endometrioid endometrium carcinoma and endometrial hyperplasia. International Journal of Clinical and Experimental Pathology. 8(5): 5633-5641.

Background

Folate Receptor 1 (FOLR1), also known as Folate Receptor alpha and Folate Binding Protein (FBP), is a 37-42 kDa protein that mediates the cellular uptake of folic acid and reduced folates. FOLR1 is predominantly expressed on epithelial cells and is dramatically upregulated on many carcinomas. Mature FOLR1 is an N-glycosylated protein that is anchored to the cell surface by a GPI linkage. FOLR1 is internalized to the endosomal system where it dissociates from its ligand before recycling to the cell surface. The soluble form of FOLR1 can be shed from the cell surface and into serum and breast milk through protein hydrolysis.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.