CD200 His Tag Protein, Mouse,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	CD200
Synonyms	My033，CD200 Antigen，Antigen Identified By Monoclonal Antibody MRC OX-2，MOX1，OX-2 Membrane Glycoprotein，OX-2，MRC，CD200 Molecule，MOX2
Accession	O54901
Amino Acid Sequence	Gln31-Gly232, with C-terminal 8*His QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	35-50kDa (Reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Barclay A.N., Wright G.J., Brooke G., Brown M.H.CD200 and membrane protein interactions in the control of myeloid cells. TrendsImmunol. 2002;23:285–290. 2.Wright G.J., Puklavec M.J., Willis A.C., HoekR.M., Sedgwick J.D., Brown M.H., Barclay A.N. Lymphoid/Neuronal cell surfaceOX2 glycoprotein recognizes a novel receptor on macrophages implicated in thecontrol of their function. Immunity. 2000;13:233–242. 3.Moreaux J., Veyrune J.L., Reme T., De Vos J.,Klein B. CD200, A putative therapeutic target in cancer. Biochem. Biophys. Res.Commun. 2008;366:117–122. 4.Barclay A.N. Different reticular elements in ratlymphoid tissue identified by localization of IA, Thy-1 and MRC OX-2 antigens.Immunology. 1981;44:727–736.

Background

CD200 is a type-1 cell membrane glycoprotein of the immunoglobulin supergene family, present on both cells with myeloid/lymphoid origin as well as on epithelial cells and many cancer cells. CD200, also known as MRC OX-2, is a highly conserved, 48 kDa type 1a transmembrane glycoprotein related structurally to the B7 family of costimulatory receptors.The molecule itself consists of an IgSF extracellular domain (single V + C), a single transmembrane region and a short cytoplasmic tail lacking signaling motifs. The molecule is expressed by resting dendritic cells, thymocytes, endothelial cells, neurons and osteoblast precursors (OBp), as well as by activated B and T cells (including αβTCR+ and most γδTCR+ cells). CD200 interacts with a structurally related receptor (CD200R) expressed mainly on myeloid cells and is involved in regulation of macrophage and mast cell function. OX-2 / CD200 and CD200R associate via their respective N-terminal Ig-like domains. CD200 also plays an important role in prevention of graft rejection, autoimmune diseases and spontaneous abortion.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.