ROBO4 His Tag Protein, Mouse,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	ROBO4
Synonyms	roundabout, axon guidance receptor, homolog 4 (Drosophila)
Accession	Q8C310
Amino Acid Sequence	Leu28-Glu470, with C-terminal 8*His LDSPPQILVHPQDQLLQGSGPAKMRCRSSGQPPPTIRWLLNGQPLSMATPDLHYLLPDGTLLLHRPSVQGRPQDDQNILSAILGVYTCEASNRLGTAVSRGARLSVAVLQEDFQIQPRDTVAVVGESLVLECGPPWGYPKPSVSWWKDGKPLVLQPGRRTVSGDSLMVSRAEKNDSGTYMCMATNNAGQRESRAARVSIQESQDHKEHLELLAVRIQLENVTLLNPEPVKGPKPGPSVWLSWKVSGPAAPAESYTALFRTQRSPRDQGSPWTEVLLRGLQSAKLGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEQVPSAPPQGVTLRSGNGSVFVSWAPPPAESHNGVIRGYQVWSLGNASLPAANWTVVGEQTQLEIATRLPGSYCVQVAAVTGAGAGELSTPVCLLLEQAMEQSARDPRKHVPWTLEQLRATLRRPEGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	60-75kDa (Reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Xiao, W., Pinilla-Baquero, A., Faulkner, J. etal. Robo4 is constitutively shed by ADAMs from endothelial cells and the shedRobo4 functions to inhibit Slit3-induced angiogenesis. Sci Rep 12, 4352 (2022).https://doi.org/10.1038/s41598-022-08227-8.

Background

Roundabout homolog 4, also known as magic roundabout and ROBO4 is a member of the immunoglobulin superfamily and ROBO family.Roundabout 4 (Robo4) is a transmembrane receptor that expresses specifically in endothelial cells. ROBO4 contains two fibronectin type-III domains and two Ig-like C2-type (immunoglobulin-like) domains. ROBO4 is predominantly expressed in embryonic or tumor vascular endothelium and is considered important for vascular development and as a candidate tumor endothelial marker. ADAM10 and ADAM17 are abscisic enzymes of Robo4, and the negative regulation of their ligand Slit3 is a new control mechanism of Robo4 signaling in angiogenesis.

Protocol

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.