GPA33 His Tag Protein, Human,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	GAP33
Synonyms	Glycoprotein A33, Cell surface A33 antigen
Accession	Q99795
Amino Acid Sequence	Ile22-Val235, with C-terminal 8* His ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	34-39kDa(Reducing)
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Sakamoto J., Kojima H., Kato J. Hamashima H., Suzuki H. Organ-specific expression of the intestinal epithelium-related antigen A33, a cell surface target for antibody-based imaging and treatment in gastrointestinal cancer. Cancer Chemother Pharmacol. 2000;46 Suppl: S27–32.2.Ackerman M.E., Chalouni C., Schmidt M.M., Raman V.V., Ritter G., Old L.J., Mellman I., Wittrup K.D. A33 antigen displays persistent surface expression. Cancer Immunol Immunother. 2008;57(7):1017–27.

Background

GpA33 is a cell-surface differentiation antigen that belongs to the immunoglobulin superfamily. The GpA33 encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. GpA33 antigen is a cell surface glycoprotein of the small intestine and colonic epithelium with homology to tight junction-associated proteins of the immunoglobulin superfamily, including CAR and JAM. Immunohistochemical study of normal tissues identified the large and small intestinal mucosa as the principal site of A33 expression. GpA33 is found in 95% of primary and metastatic colorectal cancers, with uniform expression throughout the tumors in most cases. Because of its presence only in the intestine or in tumors in the intestine, the gpA33 has been evaluated as a target for the detection and radioimmunotherapy of colon cancer tumors.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.