B7-H4 Fc Chimera Protein, Mouse,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	B7-H4
Synonyms	V-set domain containing T-cell activation inhibitor 1, B7 homolog 4 (B7-H4), Immune costimulatory protein B7-H4
Accession	Q7TSP5-1
Amino Acid Sequence	Leu25-Gly257, with C-terminal Human IgG1 Fc LIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System	HEK293
Molecular Weight	72-85kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	Human Fc
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Yi, K.H. and L. Chen (2009) Immunol. Rev. 229:145. 2. Salceda, S. et al. (2005) Exp. Cell Res. 306:128. 3. Zang, X. et al. (2003) Proc. Natl. Acad. Sci. 100:10388.

Background

V-set domain-containing T-cell activation inhibitor 1 (VTCN1) is also known as Immune costimulatory protein B7-H4, Protein B7S1, T-cell costimulatory molecule B7x, B7H4, which belongs to the immunoglobulin superfamily and BTN/MOG family. VTCN1 contains two Ig-like V-type (immunoglobulin-like) domains. The expression of VTCN1 is up-regulated by IL6 and IL10 and is inhibited by GM-CSF and IL4 on antigen-presenting cells (APCs). VTCN1/B7-H4 negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. VTCN1 involved in promoting epithelial cell transformation.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.