Human Urokinase Protein, His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Urokinase-type plasminogen activator, U-plasminogen activator, uPA, PLAU
Accession	P00749
Amino Acid Sequence	Protein sequence (P00749, Ser21-Leu431, with C-His tag) SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Expression System	HEK293
Molecular Weight	Predicted MW: 48.1 kDa Observed MW: 54 kDa
Purity	锛?5% by SDS-PAGE
Endotoxin	<0.1EU/渭g
Conjugation	Unconjugated
Tag	with C-His tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Urokinase - type plasminogen activator is a serine protease that plays a crucial role in the fibrinolytic system. It is mainly produced and secreted by various cells, such as endothelial cells and monocytes. u - PA specifically converts plasminogen into plasmin, which is capable of degrading fibrin clots and extracellular matrix proteins. This process is essential for maintaining the balance of blood coagulation and fibrinolysis, as well as for tissue remodeling and wound healing. Dysregulation of u - PA has been implicated in many pathological conditions, including thrombosis, cancer metastasis, and inflammatory diseases. Therefore, u - PA is an important target for the development of drugs to treat these diseases.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.