Human NTB-A/SLAMF6/CD352 Protein, hFc tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	SLAM family member 6, Activating NK receptor, NK-T-B-antigen (NTB-A), CD352, SLAMF6, KALI
Accession	Q96DU3
Amino Acid Sequence	Protein sequence (Q96DU3, Asn31-Gly239, with C-hFc tag) NGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFG
Expression System	HEK293
Molecular Weight	Predicted MW: 49.6 kDa Observed MW: 60-70 kDa
Purity	锛?5% by SDS-PAGE
Endotoxin	<0.1EU/渭g
Conjugation	Unconjugated
Tag	with C-hFc tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

SLAM family member 6 is a protein that in humans is encoded by the SLAMF6 gene. The protein is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. It is expressed on natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.