Human Calretinin Protein, His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	CR, 29 kDa calbindin, CALB2, CAB29
Accession	P22676
Amino Acid Sequence	Protein sequence (P22676, Met1-Met271, with N-His tag) MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM
Expression System	E.coli
Molecular Weight	Predicted MW: 33.2 kDa Observed MW: 33 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	with N-His tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Calretinin is a calcium-binding protein involved in calcium signaling. Calretinin belongs to the troponin C superfamily. This protein plays a role in diverse cellular functions, including message targeting and intracellular calcium buffering. Calretinin is abundantly expressed in neurons including retina and cortical interneurons. Calretinin has an important role as a modulator of neuronal excitability including the induction of long-term potentiation. Loss of expression of calretinin in hippocampal interneurons has been suggested to be relevant in temporal lobe epilepsy. It is expressed in a number of other locations including hair follicles. Calretinin is a diagnostic marker for some human diseases, including Hirschsprung disease and some cancers.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.