Human CCL4 Protein, hFc tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	C-C motif chemokine 4, G-26 T-lymphocyte-secreted protein, HC21, Lymphocyte activation gene 1 protein (LAG-1), MIP-1-beta (1-69), Macrophage inflammatory protein 1-beta (MIP-1-beta), PAT 744, Protein H400, SIS-gamma, Small-inducible cytokine A4, T-cell activation protein 2 (ACT-2), LAG1, MIP1B, SCYA4
Accession	P13236
Amino Acid Sequence	Protein sequence (P13236, Ala24-Asn92, with C-hFc tag) APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Expression System	HEK293
Molecular Weight	Predicted MW: 33.9 kDa Observed MW: 40 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	with C-hFc tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CCL4 is a small cytokine that belongs to the CC chemokine subfamily. CCL4 is being secreted under mitogenic signals and antigens and hereby acts as a chemoattractant for natural killer cells, monocytes and various other immune cells in the site of inflamed or damaged tissue. CCL4 is produced by: monocytes, B cells, T cells, NK cells, dendritic cells, neutrophils, fibroblasts, endothelial cells such as vascular smooth muscle cells, brain microvessel endothelial cells, fetal microglia and epithelial cells. CCL4 is a major HIV-suppressive factor produced by CD8+ T cells.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.