Mouse NCR1 Protein, His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	Natural cytotoxicity triggering receptor 1, Activating receptor 1 (mAR-1), Lymphocyte antigen 94, Natural killer cell p46-related protein (NK-p46; NKp46; mNKp46), CD335, Ly94
Accession	Q8C567
Amino Acid Sequence	Protein sequence (Q8C567, Glu22-Asn255, with C-His tag) EKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN
Expression System	HEK293
Molecular Weight	Predicted MW: 28.2 kDa Observed MW: 40-50 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Tag	with C-His tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

NKp46, along with NKp30 and NKp44, are activating receptors that have been collectively termed the natural cytotoxicity receptors (NCR). Mouse NKp46, also known as MAR-1, is a type I transmembrane protein with two extracellular Ig-like domains. It has a positive charge in its transmembrane domain that permits association with the ITAM-bearing signal adapter proteins, CD3 zeta and Fc epsilon RI gamma. Studies with neutralizing antibodies indicate that the three NCR are primarily responsible for triggering the NK‑mediated lysis of many human tumor cell lines. Blocking any of the NCRs individually resulted in partial inhibition of tumor cell lysis, but nearly complete inhibition of lysis was observed if all three receptors were blocked simultaneously. NKp46 has also been implicated in recognition of virus‑infected cells through its capacity to bind to viral hemagglutinins.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.