Mouse CD3 epsilon Protein, hFc tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	T-cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, Cd3e
Accession	P22646
Amino Acid Sequence	Protein sequence (P22646, Asp23-Asp108, with C-hFc tag) DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Expression System	HEK293
Molecular Weight	Predicted MW: 36 kDa Observed MW: 43 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	with C-hFc tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD3e molecule, epsilon also known as CD3E. The protein is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause severe immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. T-cell surface glycoprotein CD3 epsilon chain has been shown to interact with TOP2B, CD3EAP and NCK2.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.