Human IL-12A, His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1
Accession	P29459
Amino Acid Sequence	Protein sequence (P29459, Arg23-Ser219, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Predicted MW: 24.2 kDa Observed MW: 35-45 kDa
Purity	＞90% by SDS-PAGE
Endotoxin	<1EU/μg
Tag	with C-10*His
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-12 subunit alpha (IL-12 p35) is a protein that in humans is encoded by the IL12A gene. This gene encodes a subunit of the cytokine Interleukin 12 (IL-12) that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-dependent induction of interferon gamma (IFN-γ), and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.