SARS-CoV-2 (BQ.1.1/Omicron) RBD, His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	SARS-CoV-2
Accession	P0DTC2
Amino Acid Sequence	Protein sequence(P0DTC2, Arg319-Lys537, with C-10*His) RVQPTESIVRFPNITNLCPFDEVFNATTFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSTVGGNYNYRYRLFRKSKLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Theoretical: 26.3kDa Actual: 33kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.